PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D11G3038
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 371aa    MW: 40897.5 Da    PI: 9.8254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D11G3038genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.1e-18118163147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+++  gR++k+c++rw++ 
      Gh_D11G3038 118 RGHWRPAEDARLKELVTQYGPQNWNLIAEHLE-GRSGKSCRLRWFNQ 163
                      899*****************************.***********996 PP

2Myb_DNA-binding55.71.2e-17170213146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a+k +G++ W++Iar ++ gRt++ +k++w+ 
      Gh_D11G3038 170 RRAFSEEEEERLLTAHKVYGNK-WALIARLFP-GRTDNAVKNHWHV 213
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.147113164IPR017930Myb domain
SMARTSM007174.1E-14117166IPR001005SANT/Myb domain
PfamPF002495.1E-16118163IPR001005SANT/Myb domain
SuperFamilySSF466892.47E-28118211IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-26119171IPR009057Homeodomain-like
CDDcd001673.40E-13121162No hitNo description
PROSITE profilePS5129426.698165219IPR017930Myb domain
SMARTSM007172.7E-15169217IPR001005SANT/Myb domain
PfamPF002499.5E-15170212IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-20172218IPR009057Homeodomain-like
CDDcd001671.99E-12172212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MSPLNLSNDF NCYNGGEVQE RNFLSLPSIF PHQIGRDTKN SEMGFQIPTS LMEQSNKSLS  60
FDPFQTRGTD GVVAAGDGKS GFLGVEKKGL SLNLSVENES NKTPGGSVKN GHTKLCSRGH  120
WRPAEDARLK ELVTQYGPQN WNLIAEHLEG RSGKSCRLRW FNQLDPRINR RAFSEEEEER  180
LLTAHKVYGN KWALIARLFP GRTDNAVKNH WHVIMARKHR EQSSIYRRRR PSSSASFPKG  240
LDLTVRNNAS SDQSTISCSN STSTDLALTP SSTKKVVPPH QIFTTFSGVH QKGEKVKVGS  300
SGNGDFGKYG SQQRPMGVVM GVDQYANSSD SNSEISATES VGTNRTNNSQ TAIGDDKINM  360
HFIDFLGVGA S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-341182187107B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225230YRRRRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434768.10.0PREDICTED: myb-like protein Q
TrEMBLA0A0D2R4610.0A0A0D2R461_G
STRINGPOPTR_0019s05740.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17800.13e-69myb domain protein 56